GPM10100152982: ENSP00000269576

| model | homologues | context | group | gel | chip | peptide | table | details | GO |
| BTO | path | ppi | doms | snaps | mh | XML | wiki |

| ensembl | ncbi | pubmed | omim | hprd | unigene | snps | geo |
hpa |
| kegg | hmdb | grid | string | p-site | pep-atlas | mrm | gpmDB | wiki | pSYT | SNAP |
Sample information
Show:
 (n) (ω) Display as: Show/hide: save | clear 
 ENSP00000269576:
log(e) = -25.8 		 keratin 10
    [Source: HGNC 6413]
    IPR016044 F
    IPR018039 Intermediate filament CS
    IPR002957 Keratin I
    IPR009053 Prefoldin
    IPR000817 Prion
     (validate)
(mrm)
 1  msvryssskhysssysggggggggcgggggvsslrissskgslgggfssggfsggsfsrg
MSVRYSSSKHYSSSRSGGGGGGGGCGGGGGVSSLRISSSKGSLGGGFSSGGFSGGSFSRG		  60
 61  ssgggcfggssggygglggfgggsfrgsygsssfggsyggmfgggsfgggsfgggsfggg
SSGGGCFGGSSGGYGGLGGFGGGSFRGSYGSSSFGGSYGGIFGGGSFGGGSFGGGSFGGG		  120
 121  gfggryfgggfgggrggrrgllsgnekvtmqnskdkrssmrdkvraleesnyelegkike
GFGGGGFGGGFGGGFGGDGGLLSGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKE		  180
 181  ryekhgnsyqgeprdyskyyktiddlknqilnltwdnanillqidnarlaaddfrlkyen
WYEKHGNSHQGEPRDYSKYYKTIDDLKNQILNLTTDNANILLQIDNARLAADDFRLKYEN		  240
 241  evalrqsveadinglrrvldeltltkrdyemqieslteelaylkknyeeemkslrnvsrg
EVALRQSVEADINGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTG		  300
 301  dvnvemnaapgvdltqllnnmrsqyeqlaeqnrkdaeawfnekskeltteidnnieqiss
DVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISS		  360
 361  ykseitelrrnvqaleielqsqlalkqsleaslaetegrycvqlsqiqaqisaleeqlqs
YKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQ		  420
 421  iraetecqnteyqrlldiyirweneiqtyryllegegssggggrgggsfgggygggssgg
IRAETECQNTEYQQLLDIKIRLENEIQTYRSLLEGEGSSGGGGRGGGSFGGGYGGGSSGG		  480
 481  gssgggrggghggssgggygggssgggssgggygggsssgghggsssggygggssggggg
GSSGGGHGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGG		  540
 541  gygggssgggsssgggygggsssgghkssssgsvgessskgpry
GYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVGESSSKGPRY		  584

 Identified Peptides

spectrumlog(e)log(I)m+hdeltaz sequencen
7867.1-5.63.101381.6481.0922dkvr166ALEESNYELE GK  177ikew()
7569.1-5.33.021381.6480.5942dkvr166ALEESNYELE GK  177ikew()
7707.1-4.72.941381.6480.6922dkvr166ALEESNYELE GK  177ikew()
7505.1-4.63.081381.6480.6132dkvr166ALEESNYELE GK  177ikew()
7773.1-4.43.041381.6480.6542dkvr166ALEESNYELE GK  177ikew()
7637.1-4.13.261381.6480.2752dkvr166ALEESNYELE GK  177ikew()
8835.1-3.22.841109.4900.5102qnrk335DAEAWFNEK  343skel()
8902.1-2.82.691109.4900.0472qnrk335DAEAWFNEK  343skel()
8967.1-2.72.871109.4900.3852qnrk335DAEAWFNEK  343skel()
7564.1-5.22.991262.597-0.0662qtyr451SLLEGEGSSG GGGR  464gggs()
7300.1-3.02.971262.5970.7052qtyr451SLLEGEGSSG GGGR  464gggs()
7466.1-2.32.821262.5970.3052qtyr451SLLEGEGSSG GGGR  464gggs()
7404.1-2.02.911262.5970.6802qtyr451SLLEGEGSSG GGGR  464gggs()

 Protein Information

press if the information below appears incomplete
ENSEMBL Protein report: ENSP00000269576

Description: keratin 10 [Source:HGNC Symbol;Acc:6413]

Location
Chromosome 17: 38,974,369-38,978,847 reverse strand.
Gene
This transcript is a product of gene ENSG00000186395 - There are 2 transcripts in this gene
Name Transcript ID Length (bp) Protein ID Length (aa) Biotype CCDS
KRT10-002 ENST00000269576 2124 ENSP00000269576 584 Protein codingA protein coding transcript is a spliced mRNA that leads to a protein product.CCDS11377
KRT10-001 ENST00000459776 614 No protein product - Processed transcriptNoncoding transcript that does not contain an open reading frame (ORF). -
Protein Sequence:

BLAST this sequence

Key

MSVRYSSSKHYSSSYSGGGGGGGGCGGGGGVSSLRISSSKGSLGGGFSSGGFSGGSFSRG
SSGGGCFGGSSGGYGGLGGFGGGSFRGSYGSSSFGGSYGGMFGGGSFGGGSFGGGSFGGG
GFGGRYFGGGFGGGRGGRRGLLSGNEKVTMQNSKDKRSSMRDKVRALEESNYELEGKIKE
RYEKHGNSYQGEPRDYSKYYKTIDDLKNQILNLTWDNANILLQIDNARLAADDFRLKYEN
EVALRQSVEADINGLRRVLDELTLTKRDYEMQIESLTEELAYLKKNYEEEMKSLRNVSRG
DVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISS
YKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQS
IRAETECQNTEYQRLLDIYIRWENEIQTYRYLLEGEGSSGGGGRGGGSFGGGYGGGSSGG
GSSGGGRGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGG
GYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVGESSSKGPRY
Domains
Domain type Start End Description Accession InterPro
Prosite_profiles 2 97 - PS50324 -
Prints 15 30 - PR01228 -
Prosite_profiles 17 575 - PS50315 -
Prints 40 50 - PR01228 -
Prints 68 86 - PR01228 -
Prosite_profiles 477 579 - PS50324 -
Pfam 145 459 F PF00038 IPR016044 [Display all genes with this domain]
Prosite_patterns 446 454 Intermediate_filament_CS PS00226 IPR018039 [Display all genes with this domain]
Prints 227 240 Keratin_I PR01248 IPR002957 [Display all genes with this domain]
Prints 248 271 Keratin_I PR01248 IPR002957 [Display all genes with this domain]
Prints 302 322 Keratin_I PR01248 IPR002957 [Display all genes with this domain]
Prints 374 389 Keratin_I PR01248 IPR002957 [Display all genes with this domain]
Prints 400 426 Keratin_I PR01248 IPR002957 [Display all genes with this domain]
Superfamily 259 380 Prefoldin 46579 IPR009053 [Display all genes with this domain]
Smart 58 289 Prion SM00157 IPR000817 [Display all genes with this domain]
Prints 465 480 Prion PR00341 IPR000817 [Display all genes with this domain]
Prints 483 498 Prion PR00341 IPR000817 [Display all genes with this domain]
Prints 526 545 Prion PR00341 IPR000817 [Display all genes with this domain]
Other features
Feature type Start End
Coiled coil 150 184
Coiled coil 203 223
Coiled coil 245 293
Coiled coil 314 338
Coiled coil 351 392
Coiled coil 404 431
Low complexity 2 144
Low complexity 455 581
Residue Variation ID Variation type Alleles Ambiguity code Alternate residues
15 rs28411890 Non-synonymous C/T Y H, R
101 rs4261597 Non-synonymous A/C M S, I
125 rs71371451 Synonymous G/A R -
126 GA014320 Non-synonymous C/T Y S, G
135 rs1132252 Synonymous A/G R -
138 rs1132253 Synonymous A/G R -
139 rs1132254 Synonymous A/G R -
150 rs58901407 Non-synonymous A/C M M, R
153 rs61460100 Non-synonymous G/C S L, V
154 rs57784225 Non-synonymous T/G K H, N
156 rs60712939 Non-synonymous G/T KY S, H, N, R
157 rs1132255 Synonymous G/A R -
158 rs59175042 Non-synonymous C/G SR A, P
160 rs58414354 Non-synonymous A/C MK A, S, D, Y
161 rs1132257 Non-synonymous A/G RR S, P, L
162 rs56809156 Frameshift GTCCAA/- -
181 rs1132258 Non-synonymous A/G R W, R
189 rs1132259 Non-synonymous T/C Y H, R
215 rs1132260 Synonymous A/T W -
267 rs1132262 Synonymous A/G R -
269 rs1132263 Synonymous C/T Y -
287 rs1132264 Non-synonymous T/C Y H, R
293 rs1132265 Non-synonymous C/G S H, D
299 rs1132266 Synonymous A/G R -
420 rs1132268 Non-synonymous G/C S Q, E
434 rs60035576 Non-synonymous G/A R Q, *
439 rs61434181 Non-synonymous T/C Y K, E
442 rs58026994 Non-synonymous A/T W Q, L
451 rs1132269 Non-synonymous T/C Y S, G
473 rs72074479 Frameshift GAGCTTCCGCCGCCG/- -
474 rs72074479 Frameshift GAGCTTCCGCCGCCG/- -
475 rs72074479 Frameshift GAGCTTCCGCCGCCG/- -
476 rs72074479 Frameshift GAGCTTCCGCCGCCG/- -
477 rs72074479 Frameshift GAGCTTCCGCCGCCG/- -
478 rs72074479 Frameshift GAGCTTCCGCCGCCG/- -
487 rs17855579 Non-synonymous G/A R H, Y
570 GA032452 Non-synonymous G/C S S, C

This transcript corresponds to the following database identifiers:

HGNC Symbol:
UCSC Stable ID:
uc002hvi.2 [view all locations]
CCDS:
CCDS11377.1 [view all locations]
Human Protein Atlas:
CAB000132 [view all locations]
CAB000132 [view all locations]
HPA012014 [view all locations]
HPA012014 [view all locations]
WikiGene:
UniProtKB/Swiss-Prot:
K1C10_HUMAN [align]
Keratin, type I cytoskeletal 10 (Cytokeratin-10)(CK-10)(Keratin-10)(K10) [view all locations]
RefSeq peptide:
NP_000412.3 [Target %id: 99; Query %id: 99] [align]
keratin, type I cytoskeletal 10 [view all locations]
RefSeq DNA:
NM_000421.3 [align]
keratin 10 (KRT10), mRNA [view all locations]
EntrezGene:
EMBL:
AC090283 [align] [view all locations]
BC034697 [align] [view all locations]
J04029 [align] [view all locations]
L20218 [align] [view all locations]
L20219 [align] [view all locations]
M19156 [align] [view all locations]
M77663 [align] [view all locations]
X14487 [align] [view all locations]
HGNC (curated):
KRT10-002 [view all locations]
IPI:
IPI00009865.4 [Target %id: 100; Query %id: 100]
Gene_Symbol=KRT10 Keratin, type I cytoskeletal 10 [view all locations]
MIM disease:
113800
EPIDERMOLYTIC HYPERKERATOSIS [view all locations]
607602
ICHTHYOSIS, CYCLIC, WITH EPIDERMOLYTIC HYPERKERATOSIS [view all locations]
MIM gene:
Protein ID:
AAA59199.1 [align] [view all locations]
AAA59468.1 [align] [view all locations]
AAA60544.1 [align] [view all locations]
AAB59438.1 [align] [view all locations]
AAB59439.1 [align] [view all locations]
AAH34697.1 [align] [view all locations]
CAA32649.1 [align] [view all locations]
UniGene:
Hs.99936 [Target %id: 99; Query %id: 98]
Keratin 10 [view all locations]
Contributor: Dave Tabb
project comment Data transfer from Tranche. Published in Am J Physiol Gastrointest Liver Physiol. 2007 May;292(5):G1249-62. PMID: 17255364.
project VUMC Goldenring LTQ RPLC analysis of immunoisolated human gastric vesicles
BRENDA tissue BTO:0000502 
institution Vanderbilt University

Column notes.
  1. spectrum: written in the form "X.Y", where X is a unique identifier for a particular tandem mass spectrum in this data set and Y is an identifier for this particular sequence solution.
  2. log(e): the base-10 log of the expectation that any particular peptide assignment was made at random (E-value).
  3. log(I): the base-10 log of the sum of the fragment ion intensities in the tandem mass spectrum used to make this assignment.
  4. m+h: the calculated mass of the protonated parent ion for this sequence assignment.
  5. delta: the difference between the measured and calculated protonated parent ion masses.
  6. z: the charge of the parent ion measured.
  7. sequence: the sequence of the assigned peptide sequence. The sequences immediately N-terminal and C-terminal to the assigned peptide in the protein sequence are also shown.
  8. n: the number of observations of this peptide sequence in GPMDB.
  9. ω: the frequency of observation for this peptide in this protein (only available for some species).
Display modes:
  1. best: the peptide assignment with the best expectation value for a particular sequence and parent ion charge is shown.
  2. all: all peptide assignments are shown.
  3. modified: all peptide assignments that have at least one modified residue are shown.
  4. homologues: all peptides assignments unique to this protein sequence are shown.


protein.pl, v. 2010.09.03